Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABH2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ABH2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156921
|
Novus Biologicals
NBP156921 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ABH2 Polyclonal specifically detects ABH2 in Human samples. It is validated for Western Blot.Specifications
| ABH2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 2OG-Fe(II) oxy DC1, ABH2FLJ99103, alkB, alkylation repair homolog 2 (E. coli), Alkylated DNA repair protein alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase alkB homolog 2, EC 1.14.11.-, MGC90512, Oxy DC1 | |
| ALKBH2 | |
| IgG | |
| Affinity Purified | |
| 29 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q6NS38 | |
| 121642 | |
| Synthetic peptides corresponding to ALKBH2(alkB, alkylation repair homolog 2 (E. coli)) The peptide sequence was selected from the middle region of ABH2 (NP_001001655). Peptide sequence VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title