Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABHD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ABHD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ABHD1 Polyclonal specifically detects ABHD1 in Human samples. It is validated for Western Blot.Specifications
ABHD1 | |
Polyclonal | |
Rabbit | |
NP_115993 | |
84696 | |
Synthetic peptide directed towards the middle region of human ABHD1The immunogen for this antibody is ABHD1. Peptide sequence GLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
abhydrolase domain containing 1, EC 3.1.1, EC 3.1.1.-, FLJ36128, LABH1abhydrolase domain-containing protein 1, Lung alpha/beta hydrolase 1 | |
ABHD1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title