Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABHD13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ABHD13 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ABHD13 Polyclonal specifically detects ABHD13 in Human samples. It is validated for Western Blot.Specifications
ABHD13 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
abhydrolase domain containing 13, abhydrolase domain-containing protein 13, bA153I24.2, BEM46L1, C13orf6, chromosome 13 open reading frame 6, EC 3.-, FLJ14906, MGC27058, RP11-153I24.2 | |
ABHD13 | |
IgG | |
38 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q7L211 | |
84945 | |
Synthetic peptides corresponding to ABHD13(abhydrolase domain containing 13) The peptide sequence was selected from the N terminal of ABHD13. Peptide sequence SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title