ABI2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24963725UL

Catalog No. NB395582

Description

ABI2 Polyclonal antibody specifically detects ABI2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ABI2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Abelson interactor 2, Abi-2, ABI2B, abl binding protein 3, abl interactor 2, Abl-binding protein 3, AblBP3ABI-2, abl-interacting protein 1 (SH3-containing protein), abl-interactor 2, abl-interactor protein 2b, AIP-1, arg protein tyrosine kinase-binding protein, Arg-binding protein 1, argBP1, ARGBPIA, argBPIB, SSH3BP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 10152
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified