Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABLIM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | ABLIM1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ABLIM1 Polyclonal specifically detects ABLIM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ABLIM1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O14639 | |
| 3983 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QGSTVWHPDCKQSTKTEEKLRLPNIRRSSSDFFYSKSLIRRTGRSPSLQPTRTSS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ABLIM, abLIM-1, actin binding LIM protein 1, Actin-binding double zinc finger protein, actin-binding double-zinc-finger protein, actin-binding LIM protein 1, Actin-binding LIM protein family member 1, DKFZp781D0148, FLJ14564, KIAA0059, LIM actin-binding protein 1, LIMAB1MGC1224, LIMATIN | |
| ABLIM1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title