Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ ABR Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA578708
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, mouse brain tissue. IHC: mouse brain tissue, rat brain tissue, human mammary cancer tissue.
This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis, suggesting that Rho-related GTPases help coordinate motor skills and balance. Alternatively spliced transcript variants that encode different isoforms have been reported for this gene.
Specifications
ABR | |
Polyclonal | |
Unconjugated | |
ABR | |
ABR; active BCR-related; active BCR-related gene; active breakpoint cluster region-related protein; MDB | |
Rabbit | |
Antigen affinity chromatography | |
RUO | |
109934, 287537, 29 | |
-20°C | |
Lyophilized |
Immunohistochemistry (Paraffin), Western Blot | |
500 μg/mL | |
PBS with 5mg BSA and 0.05mg sodium azide | |
Q12979, Q5SSL4 | |
ABR | |
A synthetic peptide corresponding to a sequence in the middle region of human ABR (370-407aa HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Safety and Handling
WARNING: Cancer - www.P65Warnings.ca.gov
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction