Invitrogen™ ABR Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578708

Catalog No. PIPA578708

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, mouse brain tissue. IHC: mouse brain tissue, rat brain tissue, human mammary cancer tissue.

This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis, suggesting that Rho-related GTPases help coordinate motor skills and balance. Alternatively spliced transcript variants that encode different isoforms have been reported for this gene.

Specifications

• Antigen: ABR
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ABR
• Gene Alias: ABR; active BCR-related; active BCR-related gene; active breakpoint cluster region-related protein; MDB
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 109934, 287537, 29
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q12979, Q5SSL4
• Gene Symbols: ABR
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ABR (370-407aa HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov