Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABRA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | ABRA |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ABRA Polyclonal specifically detects ABRA in Human samples. It is validated for Western Blot.Specifications
| ABRA | |
| Polyclonal | |
| Rabbit | |
| NP_631905 | |
| 137735 | |
| Synthetic peptide directed towards the middle region of human ABRAThe immunogen for this antibody is ABRA. Peptide sequence QWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| actin-binding Rho activating protein, actin-binding Rho-activating protein, STARSStriated muscle activator of Rho-dependent signaling | |
| ABRA | |
| IgG | |
| 43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title