Invitrogen™ ac Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA569771

Catalog No. PIPA569771

Description

This target displays homology in the following species: Human: 79%; Rat: 85% Peptide sequence: FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. Concentration is batch dependent: 0.5-1 mg/mL.

AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.

Specifications

• Antigen: ac
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ac
• Gene Alias: 990 E5 F1; Ac; achaete; Achaete/Scute; achaete-scute; Achaete-scute complex protein T5; acheate; achete; ac-PA; ASC; AS-C; AS-C T5; AS-C T5ac; ascT5; CG3796; CG3796-PA; Dmel\CG3796; Dmel_CG3796; EG:125H10.3; hairy wing; Hairy-wing; Hw; IP01413p; Protein achaete; sc/T5; T5
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 30981
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Form: Liquid

• Applications: Western Blot
• Concentration: 0.5 mg/mL
• Formulation: PBS with 2% sucrose and 0.09% sodium azide
• Gene Accession No.: P10083
• Gene Symbols: ac
• Immunogen: synthetic peptide corresponding to a region of fruit fly ac (aa 21-70).
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Drosophila
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov