Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA569771

Invitrogen™ ac Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA569771
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA569771 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA569771 Supplier Invitrogen™ Supplier No. PA569771
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

This target displays homology in the following species: Human: 79%; Rat: 85% Peptide sequence: FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. Concentration is batch dependent: 0.5-1 mg/mL.

AS-C proteins are involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ac
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate Unconjugated
Formulation PBS with 2% sucrose and 0.09% sodium azide
Gene ac
Gene Accession No. P10083
Gene Alias 990 E5 F1; Ac; achaete; Achaete/Scute; achaete-scute; Achaete-scute complex protein T5; acheate; achete; ac-PA; ASC; AS-C; AS-C T5; AS-C T5ac; ascT5; CG3796; CG3796-PA; Dmel\CG3796; Dmel_CG3796; EG:125H10.3; hairy wing; Hairy-wing; Hw; IP01413p; Protein achaete; sc/T5; T5
Gene Symbols ac
Host Species Rabbit
Immunogen synthetic peptide corresponding to a region of fruit fly ac (aa 21-70).
Purification Method Affinity chromatography
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 30981
Target Species Drosophila
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.