Invitrogen™ ACAA2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578709

Catalog No. PIPA578709

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat liver tissue, rat lung tissue, rat brain tissue, rat kidney tissue, human Hela whole cell, mouse HEPA1-6 whole cell, mouse NIH/3T3 whole cell, mouse SP2/0 whole cell, mouse lung tissue. IHC: human intestinal cancer tissue. ICC/IF: U20S cell. Flow: HepG2 cell.

ACAA2 (3-Ketoacyl-CoA thiolase) is an enzyme that in humans is encoded by the ACAA2 gene. Acetyl-Coenzyme A acyltransferase 2 is an acetyl-CoA C-acyltransferase enzyme. The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.

Specifications

• Antigen: ACAA2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ACAA2
• Gene Alias: 0610011L04Rik; 3-ketoacyl-CoA thiolase, mitochondrial; Acaa2; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; acetyl-CoA acyltransferase 2; acetyl-Coenzyme A acyltransferase 2; acetyl-Coenzyme A acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase); Acyl-CoA hydrolase, mitochondrial; AI255831; AI265397; beta ketothiolase; beta-ketothiolase; D18Ertd240e; DSAEC; mitochondrial 3-oxoacyl-CoA thiolase; mitochondrial 3-oxoacyl-Coenzyme A thiolase; T1
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 10449, 170465, 52538
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P13437, P42765, Q8BWT1
• Gene Symbols: ACAA2
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACAA2 (207-242aa EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov