Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578709

Invitrogen™ ACAA2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578709
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578709 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578709 Supplier Invitrogen™ Supplier No. PA578709
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat liver tissue, rat lung tissue, rat brain tissue, rat kidney tissue, human Hela whole cell, mouse HEPA1-6 whole cell, mouse NIH/3T3 whole cell, mouse SP2/0 whole cell, mouse lung tissue. IHC: human intestinal cancer tissue. ICC/IF: U20S cell. Flow: HepG2 cell.

ACAA2 (3-Ketoacyl-CoA thiolase) is an enzyme that in humans is encoded by the ACAA2 gene. Acetyl-Coenzyme A acyltransferase 2 is an acetyl-CoA C-acyltransferase enzyme. The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ACAA2
Applications Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene ACAA2
Gene Accession No. P13437, P42765, Q8BWT1
Gene Alias 0610011L04Rik; 3-ketoacyl-CoA thiolase, mitochondrial; Acaa2; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; acetyl-CoA acyltransferase 2; acetyl-Coenzyme A acyltransferase 2; acetyl-Coenzyme A acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase); Acyl-CoA hydrolase, mitochondrial; AI255831; AI265397; beta ketothiolase; beta-ketothiolase; D18Ertd240e; DSAEC; mitochondrial 3-oxoacyl-CoA thiolase; mitochondrial 3-oxoacyl-Coenzyme A thiolase; T1
Gene Symbols ACAA2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human ACAA2 (207-242aa EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10449, 170465, 52538
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.