ACAA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15474620UL

Catalog No. NBP15474620

Description

ACAA2 Polyclonal specifically detects ACAA2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ACAA2
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: P42765
• Gene Symbols: ACAA2
• Immunogen: Synthetic peptides corresponding to ACAA2(acetyl-Coenzyme A acyltransferase 2) The peptide sequence was selected from the N terminal of ACAA2. Peptide sequence ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10449
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 3-ketoacyl-CoA thiolase, mitochondrial, Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 2, acetyl-Coenzyme A acyltransferase 2, beta ketothiolase, beta-ketothiolase, DSAEC, EC 2.3.1, EC 2.3.1.16, FLJ35992, FLJ95265, Mitochondrial 3-oxoacyl-CoA thiolase, mitochondrial 3-oxoacyl-Coenzyme A thiolase, T1
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG