ACADSB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP317009100UL

Catalog No. NB169094

Description

ACADSB Polyclonal antibody specifically detects ACADSB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ACADSB
• Classification: Polyclonal
• Dilution: Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: 2-MEBCAD, 2-methylbutyryl-coenzyme A dehydrogenase, ACAD7,2-methylbutyryl-CoA dehydrogenase, acyl-CoA dehydrogenase, short/branched chain, acyl-Coenzyme A dehydrogenase, short/branched chain, EC 1.3.99,2-methyl branched chain acyl-CoA dehydrogenase, EC 1.3.99.-, SBCADshort/branched chain specific acyl-CoA dehydrogenase, mitochondrial
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQN
• Quantity: 100 μg
• Research Discipline: Amino Acids Drugs and other small molecules, Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction
• Gene ID (Entrez): 36
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified