Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACADSB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31700925UL
This item is not returnable.
View return policy
Description
ACADSB Polyclonal antibody specifically detects ACADSB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
ACADSB | |
Polyclonal | |
Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
2-MEBCAD, 2-methylbutyryl-coenzyme A dehydrogenase, ACAD7,2-methylbutyryl-CoA dehydrogenase, acyl-CoA dehydrogenase, short/branched chain, acyl-Coenzyme A dehydrogenase, short/branched chain, EC 1.3.99,2-methyl branched chain acyl-CoA dehydrogenase, EC 1.3.99.-, SBCADshort/branched chain specific acyl-CoA dehydrogenase, mitochondrial | |
This antibody was developed against Recombinant Protein corresponding to amino acids: EMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQN | |
25 μg | |
Amino Acids Drugs and other small molecules, Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
36 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction