Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACBD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ACBD4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ACBD4 Polyclonal specifically detects ACBD4 in Human samples. It is validated for Western Blot.Specifications
ACBD4 | |
Polyclonal | |
Rabbit | |
Q8NC06 | |
79777 | |
Synthetic peptides corresponding to ACBD4(acyl-Coenzyme A binding domain containing 4) The peptide sequence was selected from the N terminal of ACBD4. Peptide sequence NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
acyl-CoA binding domain containing 4, acyl-CoA-binding domain-containing protein 4, acyl-Coenzyme A binding domain containing 4, FLJ13322, FLJ90623 | |
ACBD4 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title