Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACBD5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$493.10
Specifications
| Antigen | ACBD5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ACBD5 Polyclonal specifically detects ACBD5 in Human samples. It is validated for Western Blot.Specifications
| ACBD5 | |
| Polyclonal | |
| Rabbit | |
| Q5T8D3 | |
| 91452 | |
| Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5) The peptide sequence was selected from the N terminal of ACBD5. Peptide sequence ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| acyl-CoA binding domain containing 5, acyl-Coenzyme A binding domain containing 5, DKFZp434A2417, endozepine-related protein, KIAA1996acyl-CoA-binding domain-containing protein 5, membrane-associated diazepam binding inhibitor | |
| ACBD5 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title