Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    ACBP Antibody, Novus Biologicals™
 
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238648
Description
ACBP Polyclonal specifically detects ACBP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ACBP | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P07108 | |
| DBI | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD | |
| 0.1 mL | |
| Cancer | |
| 1622 | |
| Human | |
| IgG | 
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| acyl-Coenzyme A binding domain containing 1, acyl-Coenzyme A bindingprotein), CCK-RP, cholecystokinin-releasing peptide, trypsin-sensitive, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein), Diazepam-binding inhibitor, endozepine, EP, GABA receptor modulator, MGC70414 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            Spot an opportunity for improvement?Share a Content Correction
             
                            