Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP154806

ACBP Antibody, Novus Biologicals™
SDP

Numéro de catalogue. NBP154806 missing translation for 'brandsLinkText'
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
NBP154806 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. NBP154806 Fournisseur Novus Biologicals Code fournisseur NBP154806
Il en reste null
ajouter au panier
ajouter au panier

Description

Rabbit Polyclonal Antibody

ACBP Polyclonal specifically detects ACBP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Spécifications

Antigen ACBP
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P07108
Gene Alias acyl-Coenzyme A binding domain containing 1, acyl-Coenzyme A bindingprotein), CCK-RP, cholecystokinin-releasing peptide, trypsin-sensitive, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein), Diazepam-binding inhibitor, endozepine, EP, GABA receptor modulator, MGC70414
Gene Symbols DBI
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DBI(diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)) The peptide sequence was selected from the N terminal of DBI. Peptide sequence MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 10 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 1622
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus de résultats Afficher moins de résultats

For Research Use Only

missing translation for 'productTitle'
missing translation for 'pleaseSelectIssue'

missing translation for 'byClickingSubmit' missing translation for 'privacyPolicy'.