Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACCSL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ACCSL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ACCSL Polyclonal specifically detects ACCSL in Human samples. It is validated for Western Blot.Specifications
| ACCSL | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)-like, ACC synthase-like protein 2,1-aminocyclopropane-1-carboxylate synthase-like protein 2 | |
| ACCSL | |
| IgG | |
| 65 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q4AC99 | |
| 390110 | |
| Synthetic peptides corresponding to LOC390110(hypothetical protein) The peptide sequence was selected from the N terminal of LOC390110 (NP_001027025). Peptide sequence MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title