Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP153154
Description
ACD Polyclonal specifically detects ACD in Human samples. It is validated for Western Blot.Specifications
ACD | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
adrenocortical dysplasia homolog (mouse), Pip1, PIP1Tint1, POT1 and TIN2 organizing protein, POT1 and TIN2-interacting protein, Ptop, PTOPTpp1, TIN2 interacting protein 1, TINT1adrenocortical dysplasia protein homolog, TPP1 | |
Rabbit | |
58 kDa | |
100 μL | |
Primary | |
Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q96AP0 | |
ACD | |
Synthetic peptides corresponding to ACD(adrenocortical dysplasia homolog (mouse)) The peptide sequence was selected from the middle region of ACD (NP_001075955). Peptide sequence KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ. | |
Affinity purified | |
RUO | |
65057 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction