Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACE-2 Antibody (CL4035), Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP259037
Description
ACE-2 Monoclonal specifically detects ACE-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ACE-2 | |
Monoclonal | |
Western Blot 1:500 - 1:1000, Immunohistochemistry 1:20000 - 1:50000, Immunohistochemistry-Paraffin 1:20000 - 1:50000 | |
ACEHangiotensin I converting enzyme 2, ACE-related carboxypeptidase, angiotensin I converting enzyme (peptidyl-dipeptidase A) 2, angiotensin-converting enzyme 2, Angiotensin-converting enzyme homolog, DKFZp434A014, EC 3.4.17, EC 3.4.17.23, Metalloprotease MPROT15 | |
Mouse | |
Protein A purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG1 |
Western Blot, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
ACE2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED | |
100 μL | |
Immunology, Virology Bacteria and Parasites | |
59272 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction