Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Acetoacetyl CoA synthetase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Acetoacetyl CoA synthetase |
---|---|
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Acetoacetyl CoA synthetase Polyclonal specifically detects Acetoacetyl CoA synthetase in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Acetoacetyl CoA synthetase | |
Polyclonal | |
Rabbit | |
Human | |
Q86V21 | |
65985 | |
This antibody was developed against a recombinant protein corresponding to amino acids: RVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
acetoacetate-CoA ligase, acetoacetyl-CoA synthetase, ACSF1FLJ41251, Acyl-CoA synthetase family member 1, EC 6.2.1, EC 6.2.1.16, FLJ12389, homolog of C. elegans supressor of ras 5 (sur-5), Protein sur-5 homolog, SUR-5 | |
AACS | |
IgG | |
Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title