Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Acetyl-CoA Carboxylase alpha/ACACA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238981
Description
Acetyl-CoA Carboxylase alpha/ACACA Polyclonal specifically detects Acetyl-CoA Carboxylase alpha/ACACA in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Acetyl-CoA Carboxylase alpha/ACACA | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q13085 | |
| ACACA | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL | |
| 0.1 mL | |
| Breast Cancer, Lipid and Metabolism, Nutrient Sensing in the Brain | |
| 31 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ACACacetyl-CoA carboxylase 1, ACC1ACC, ACCA, ACC-alpha, acetyl-CoA carboxylase alpha, acetyl-Coenzyme A carboxylase alpha, EC 6.4.1.2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction