Acetyl-CoA Carboxylase alpha/ACACA Rabbit anti-Human, Mouse, Rat, Clone: 5J4W7, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP31574420UL

Catalog No. NB166584

Description

Acetyl-CoA Carboxylase alpha/ACACA Monoclonal antibody specifically detects Acetyl-CoA Carboxylase alpha/ACACA in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Acetyl-CoA Carboxylase alpha/ACACA
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Clone: 5J4W7
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ACACacetyl-CoA carboxylase 1, ACC1ACC, ACCA, ACC-alpha, acetyl-CoA carboxylase alpha, acetyl-Coenzyme A carboxylase alpha, EC 6.4.1.2
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Acetyl-CoA Carboxylase alpha/ACACA (Q13085). RLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTE
• Quantity: 20 μg
• Research Discipline: Breast Cancer, Lipid and Metabolism, Neuroscience
• Gene ID (Entrez): 31
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG