Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP310958100UL

View more versions of this product

Catalog No. NB126815

$487.50 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

ACF1 Polyclonal specifically detects ACF1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ACF1
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	ACF1hWALp1, ATP-dependent chromatin remodeling protein, ATP-dependent chromatin-remodeling protein, ATP-utilizing chromatin assembly and remodeling factor 1, bromodomain adjacent to zinc finger domain protein 1A, bromodomain adjacent to zinc finger domain, 1A, CHRAC subunit ACF1, hACF1FLJ14383, WALp1, WCRF180DKFZp586E0518, Williams syndrome transcription factor-related chromatin-remodeling factor 180
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ACF1 (NP_038476). Peptide sequence SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVS
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	11177
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

ACF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions