Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACOX3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ACOX3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ACOX3 Polyclonal specifically detects ACOX3 in Human, Mouse samples. It is validated for Western Blot.Specifications
ACOX3 | |
Polyclonal | |
Rabbit | |
O15254 | |
8310 | |
Synthetic peptides corresponding to the C terminal of ACOX3. Immunizing peptide sequence SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
acyl-CoA oxidase 3, pristanoyl, Branched-chain acyl-CoA oxidase, BRCACox, BRCOX, EC 1.3.3.6, peroxisomal acyl-coenzyme A oxidase 3, PRCOX, pristanoyl, Pristanoyl-CoA oxidase | |
ACOX3 | |
IgG | |
77 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title