Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACPT Antibody, Novus Biologicals™
SDP

Catalog No. NBP162440 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP162440 100 μL
NBP16244020 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP162440 Supplier Novus Biologicals Supplier No. NBP162440
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ACPT Polyclonal specifically detects ACPT in Human samples. It is validated for Western Blot.

Specifications

Antigen ACPT
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9BZG2
Gene Alias acid phosphatase, testicular, EC 3.1.3.2, testicular acid phosphatase
Gene Symbols ACPT
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ACPT(acid phosphatase, testicular) The peptide sequence was selected from the middle region of ACPT (NP_149059). Peptide sequence TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND.
Molecular Weight of Antigen 43 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 93650
Test Specificity Expected identity based on immunogen sequence: Human: 100%;.
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.