Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACPT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $499.50

Specifications

Antigen	ACPT
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16244020 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP16244020UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP162440 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP162440	100 μL	Each for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ACPT Polyclonal specifically detects ACPT in Human samples. It is validated for Western Blot.

Specifications

Antigen	ACPT
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	acid phosphatase, testicular, EC 3.1.3.2, testicular acid phosphatase
Gene Symbols	ACPT
Isotype	IgG
Molecular Weight of Antigen	43 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9BZG2
Gene ID (Entrez)	93650
Immunogen	Synthetic peptides corresponding to ACPT(acid phosphatase, testicular) The peptide sequence was selected from the middle region of ACPT (NP_149059). Peptide sequence TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ACPT Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents