Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACPT Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$175.82 - $436.00

Specifications

Antigen ACPT
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16244020
View Documents
Novus Biologicals
NBP16244020UL
20 μL
Each for $175.82
Add to cart
 
NBP162440
View Documents
Novus Biologicals
NBP162440
100 μL
Each for $436.00
Add to cart
 
Description

Description

ACPT Polyclonal specifically detects ACPT in Human samples. It is validated for Western Blot.
Specifications

Specifications

ACPT
Polyclonal
Rabbit
Human
Q9BZG2
93650
Synthetic peptides corresponding to ACPT(acid phosphatase, testicular) The peptide sequence was selected from the middle region of ACPT (NP_149059). Peptide sequence TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
acid phosphatase, testicular, EC 3.1.3.2, testicular acid phosphatase
ACPT
IgG
Affinity Purified
43 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit