Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACSM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	ACSM1
Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB430030 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP19164525UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP191645 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP191645	0.1 mL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ACSM1 Polyclonal specifically detects ACSM1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	ACSM1
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	acyl-CoA synthetase medium-chain family member 1EC 6.2.1.2, acyl-coenzyme A synthetase ACSM1, mitochondrial, BUCS1, Butyrate CoA ligase, Butyrate--CoA ligase 1, butyryl Coenzyme A synthetase 1, Butyryl-coenzyme A synthetase 1, EC 6.2.1, LAE, Lipoate-activating enzyme, MACS1MGC150532, medium-chain acyl-CoA synthetase, Middle-chain acyl-CoA synthetase 1
Gene Symbols	ACSM1
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q08AH1
Gene ID (Entrez)	116285
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ACSM1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents