Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACSM3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	ACSM3
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP174275 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP174275	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ACSM3 Polyclonal specifically detects ACSM3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ACSM3
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q53FZ2
Gene ID (Entrez)	6296
Immunogen	Synthetic peptides corresponding to thetase medium chain family member 3 Antibody against the N terminal of ACSM3. Immunizing peptide sequence SMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMR.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	acyl-CoA synthetase medium-chain family member 3Protein SA homolog, acyl-coenzyme A synthetase ACSM3, mitochondrial, Butyrate--CoA ligase 3, Butyryl-coenzyme A synthetase 3, EC 6.2.1, Middle-chain acyl-CoA synthetase 3, SA, SA (rat hypertension-associated) homolog, SA hypertension-associated homolog, SA hypertension-associated homolog (rat), SAH, SAHEC 6.2.1.2
Gene Symbols	ACSM3
Isotype	IgG
Molecular Weight of Antigen	66 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ACSM3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents