Abnova™ ACTB Recombinant Protein

Description

Full-length ORF with GST-tag at N-terminal

• ACTB gene encodes one of six different actin proteins
• Purification: glutathione sepharose 4 fast flow
• Molecular weight: 66.99kDa
• Preparation method:in vitro wheat germ expression system
• Storage Buffer:50 mM Tris-HCI, 10 mM reduced glutathione
• pH=8.0 in elution buffer

Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVSPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGMKILTE
RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERRYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• Accession Number: AAH01301
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Gene ID (Entrez): 60
• Molecular Weight (g/mol): 66.99
• Name: ACTB (Human) Recombinant Protein (P01)
• pH Range: 8
• Preparation Method: In vitro wheat germ expression system
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Source: Wheat Germ (in vitro)
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: PS1TP5BP1
• Common Name: ACTB
• Gene Symbol: ACTB
• Cross Reactivity: Human
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Form: Solution