Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
actin-related protein 2/3 complex subunit 1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications
Supplier: Novus Biologicals NBP190114
Description
actin-related protein 2/3 complex subunit 1B Polyclonal specifically detects actin-related protein 2/3 complex subunit 1B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
actin-related protein 2/3 complex subunit 1B | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500 | |
O15143 | |
ARPC1B | |
This antibody was developed against Recombinant Protein corresponding to amino acids:TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA | |
Affinity Purified | |
RUO | |
10095 | |
Human, Mouse, Rat | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
actin related protein 2/3 complex, subunit 1B (41 kD), actin related protein 2/3 complex, subunit 1B, 41kDa, actin-related protein 2/3 complex subunit 1B, ARC41p41-ARCp40-ARC, Arp2/3 complex 41 kDa subunit, ARP2/3 protein complex subunit p41 | |
Rabbit | |
41 kDa | |
0.1 mL | |
Primary | |
Specificity of human actin-related protein 2/3 complex subunit 1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction