Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACTL9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ACTL9 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ACTL9 Polyclonal specifically detects ACTL9 in Human samples. It is validated for Western Blot.Specifications
ACTL9 | |
Polyclonal | |
Rabbit | |
Q8TC94 | |
284382 | |
Synthetic peptides corresponding to MGC33407(hypothetical protein MGC33407) The peptide sequence was selected from the middle region of MGC33407. Peptide sequence DHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYVASQSVLSVYAHGRVS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
actin-like 9, actin-like protein 9, ACTL7C, MGC33407 | |
ACTL9 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title