Invitrogen™ alpha Actinin 3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578720

Catalog No. PIPA578720

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HT1080 whole cell, rat skeletal muscle tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, mouse skeletal muscle tissue. IHC: mouse skeletal muscle tissue, rat skeletal muscle tissue, human lung cancer tissue. Flow: WISH cell.

Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele.

Specifications

• Antigen: alpha Actinin 3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Actn3
• Gene Alias: actinin alpha 3; actinin alpha 3 (gene/pseudogene); Actinin alpha3; actinin, alpha 3; Actinin-alpha3; ACTN3; alpha-actinin skeletal muscle; Alpha-actinin skeletal muscle isoform 3; alpha-Actinin3; Alpha-actinin-3; alphaActinin-3; F-actin cross-linking protein
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11474, 171009, 89
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O88990, Q08043
• Gene Symbols: Actn3
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG