Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACTRT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ACTRT1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ACTRT1 Polyclonal specifically detects ACTRT1 in Human samples. It is validated for Western Blot.Specifications
ACTRT1 | |
Polyclonal | |
Rabbit | |
Q8TDG2 | |
139741 | |
Synthetic peptides corresponding to ACTRT1(actin-related protein T1) The peptide sequence was selected from the middle region of ACTRT1. Peptide sequence DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
actin-related protein T1, AIP1, ARIP1, ARP-T1, ARPT1HSD27, KIAA0705, MGC26590 | |
ACTRT1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title