Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ADAD2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ADAD2 Polyclonal specifically detects ADAD2 in Human samples. It is validated for Western Blot.Specifications
ADAD2 | |
Polyclonal | |
Rabbit | |
Q8NCV1 | |
161931 | |
Synthetic peptides corresponding to ADAD2(adenosine deaminase domain containing 2) The peptide sequence was selected from the middle region of ADAD2. Peptide sequence GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPP. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
adenosine deaminase domain containing 2, adenosine deaminase domain-containing protein 2, TENRLFLJ00337, Testis nuclear RNA-binding protein-like | |
ADAD2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title