ADAM19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169367

Catalog No. NBP169367

Description

ADAM19 Polyclonal specifically detects ADAM19 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ADAM19
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: a disintegrin and metalloproteinase domain 19 (meltrin beta), ADAM 19, ADAM metallopeptidase domain 19, disintegrin and metalloproteinase domain-containing protein 19, EC 3.4.24, EC 3.4.24.-, MADDAM, Meltrin-beta, Metalloprotease and disintegrin dendritic antigen marker, MLTNBmeltrin beta
• Host Species: Rabbit
• Molecular Weight of Antigen: 82 kDa
• Quantity: 100 μL
• Research Discipline: Dendritic Cell Markers
• Gene ID (Entrez): 8728
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H013
• Gene Symbols: ADAM19
• Immunogen: Synthetic peptides corresponding to ADAM19(ADAM metallopeptidase domain 19 (meltrin beta)) The peptide sequence was selected from the N terminal of ADAM19. Peptide sequence GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Canine: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only