Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ADAM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	ADAM2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP159224 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159224	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

ADAM2 Polyclonal specifically detects ADAM2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ADAM2
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	ADAM metallopeptidase domain 2, Cancer/testis antigen 15, CRYN2, CT15ADAM 2, disintegrin and metalloproteinase domain-containing protein 2, EC 3.4.24, fertilin beta, Fertilin subunit beta, FTNBCRYN1, PH-30, PH-30b, PH30PH30-beta
Gene Symbols	ADAM2
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q99965
Gene ID (Entrez)	2515
Immunogen	Synthetic peptides corresponding to ADAM2(ADAM metallopeptidase domain 2 (fertilin beta)) The peptide sequence was selected from the middle region of ADAM2. Peptide sequence PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ADAM2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents