Invitrogen™ ADAM2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578724

Catalog No. PIPA578724

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat testis tissue, mouse testis tissue, MCF-7 whole cell.

ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.

Specifications

• Antigen: ADAM2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Adam2
• Gene Alias: a disintegrin and metallopeptidase domain 2; a disintegrin and metalloprotease domain 2; a disintegrin and metalloprotease domain (ADAM) 2; a disintegrin and metalloprotease domain 2 (fertilin beta); a disintegrin and metalloproteinase; ADAM; ADAM 2; ADAM metallopeptidase domain 2; Adam2; ADAMs; AI323749; cancer/testis antigen 15; CRYN1; CRYN2; CT15; Disintegrin and metalloproteinase domain-containing protein 2; fertilin beta; fertilin subunit beta; FTNB; metalloendopeptidases; PH30; PH-30; PH-30b; Ph30-beta
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11495, 2515, 56806
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q60718, Q63202, Q99965
• Gene Symbols: Adam2
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG