Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578724

Invitrogen™ ADAM2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578724
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578724 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578724 Supplier Invitrogen™ Supplier No. PA578724
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat testis tissue, mouse testis tissue, MCF-7 whole cell.

ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ADAM2
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Adam2
Gene Accession No. Q60718, Q63202, Q99965
Gene Alias a disintegrin and metallopeptidase domain 2; a disintegrin and metalloprotease domain 2; a disintegrin and metalloprotease domain (ADAM) 2; a disintegrin and metalloprotease domain 2 (fertilin beta); a disintegrin and metalloproteinase; ADAM; ADAM 2; ADAM metallopeptidase domain 2; Adam2; ADAMs; AI323749; cancer/testis antigen 15; CRYN1; CRYN2; CT15; Disintegrin and metalloproteinase domain-containing protein 2; fertilin beta; fertilin subunit beta; FTNB; metalloendopeptidases; PH30; PH-30; PH-30b; Ph30-beta
Gene Symbols Adam2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11495, 2515, 56806
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.