ADAM28 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255995

Catalog No. NBP255995

Description

ADAM28 Polyclonal specifically detects ADAM28 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ADAM28
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: a disintegrin and metalloproteinase domain 28, ADAM metallopeptidase domain 28, ADAM23MDC-L, disintegrin and metalloproteinase domain-containing protein 28, EC 3.4.24, EC 3.4.24.-, eMDC II, eMDCII, Epididymial metalloproteinase-like, disintegrin-like, and cysteine-rich proteinII, MDCLADAM 28, MDC-Lm, MDC-Ls, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L, metalloproteinase-like, disintegrin-like, and cysteine-rich protein-L
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10863
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ADAM28
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYY
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only