Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAM28 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ADAM28 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ADAM28 Polyclonal specifically detects ADAM28 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
ADAM28 | |
Polyclonal | |
Rabbit | |
Human | |
10863 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYY | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
a disintegrin and metalloproteinase domain 28, ADAM metallopeptidase domain 28, ADAM23MDC-L, disintegrin and metalloproteinase domain-containing protein 28, EC 3.4.24, EC 3.4.24.-, eMDC II, eMDCII, Epididymial metalloproteinase-like, disintegrin-like, and cysteine-rich proteinII, MDCLADAM 28, MDC-Lm, MDC-Ls, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L, metalloproteinase-like, disintegrin-like, and cysteine-rich protein-L | |
ADAM28 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title