Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ ADAM28 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578726
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578726 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578726 Supplier Invitrogen™ Supplier No. PA578726
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, K562 whole cell.

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. Alternative splicing results in two transcript variants. The shorter version encodes a secreted isoform, while the longer version encodes a transmembrane isoform.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ADAM28
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene ADAM28
Gene Accession No. Q9UKQ2
Gene Alias a disintegrin and metallopeptidase domain 28; a disintegrin and metalloprotease domain 28; a disintegrin and metalloproteinase; a disintegrin and metalloproteinase domain 28; ADAM; ADAM 28; ADAM metallopeptidase domain 28; ADAM23; Adam28; ADAMs; C130072N01Rik; D430033C21Rik; disintegrin 1; disintegrin and metalloproteinase domain-containing protein 28; Dtgn1; eMDC II; eMDCII; Epididymal metalloproteinase-like, disintegrin-like, and cysteine-rich protein II; epididymial metalloproteinase-like, disintegrin-like, and cysteine-rich protein II; MDCL; MDC-L; MDC-Lm; MDC-Ls; metalloendopeptidases; metalloproteinase-disintegrin domain containing protein TECADAM; Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L; metalloproteinase-like, disintegrin-like, and cysteine-rich protein-L; TECADAM; Thymic epithelial cell-ADAM
Gene Symbols ADAM28
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM28 (207-248aa EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10863
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.