Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ADAM33 Antibody, Novus Biologicals™

ADAM33 Antibody, Novus Biologicals™
SDP

Catalog No. p-7107994 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159046 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159046 Supplier Novus Biologicals Supplier No. NBP159046
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ADAM33 Polyclonal specifically detects ADAM33 in Human samples. It is validated for Western Blot.

Specifications

Antigen ADAM33
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9BZ11
Gene Alias a disintegrin and metalloprotease 33, a disintegrin and metalloproteinase domain 33, ADAM 33, ADAM metallopeptidase domain 33, C20orf153, chromosome 20 open reading frame 153, disintegrin and metalloproteinase domain-containing protein 33, disintegrin and reprolysin metalloproteinase family protein, DJ964F7.1, DKFZp434K0521, EC 3.4.24.-, FLJ35308, FLJ36751, MGC149823, MGC71889
Gene Symbols ADAM33
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ADAM33(ADAM metallopeptidase domain 33) The peptide sequence was selected from the middle region of ADAM33 (NP_079496). Peptide sequence HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA.
Molecular Weight of Antigen 62 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Asthma, Cell Cycle and Replication, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 80332
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%; Rabbit: 92%; Xenopus: 84%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.