ADAMTS3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB437417	Novus Biologicals NBP23077525UL	25 μL
NBP230775	Novus Biologicals NBP230775	0.1 mL

Description

ADAMTS3 Polyclonal specifically detects ADAMTS3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ADAMTS3
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: A disintegrin and metalloproteinase with thrombospondin motifs 3, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 3, ADAM metallopeptidase with thrombospondin type 1 motif, 3, ADAM-TS 3, ADAM-TS3, ADAMTS-3, ADAMTS-4, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.14, KIAA0366PC II-NP, Procollagen II amino propeptide-processing enzyme, Procollagen II N-proteinase, zinc metalloendopeptidase
• Gene Symbols: ADAMTS3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: O15072
• Gene ID (Entrez): 9508
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KPDGANLRQRSAQQAGSKTVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGKIID
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only