Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAMTS5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
| Antigen | ADAMTS5 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ADAMTS5 Polyclonal specifically detects ADAMTS5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ADAMTS5 | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 11096 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCPLSQRPSAFKQCLLKKC | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| A disintegrin and metalloproteinase with thrombospondin motifs 11, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 5 (aggrecanase-2), ADAM metallopeptidase with thrombospondin type 1 motif, 5, ADAM-TS 11, ADAM-TS 5, ADAMTS-11, ADAM-TS5, ADAMTS-5, ADMP2, ADMP-2A disintegrin and metalloproteinase with thrombospondin motifs 5, Aggrecanase-2, disintegrin-like and metalloprotease with thrombospondin type 1 motif, 510ADAMTS11FLJ36738, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.14, EC 3.4.24.82 | |
| ADAMTS5 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title