Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAR Rabbit anti-Human, Mouse, Rat, Clone: 7H1U2, Novus Biologicals™

Rabbit Monoclonal Antibody
$205.50 - $492.50
Specifications
Antigen | ADAR |
---|---|
Clone | 7H1U2 |
Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Monoclonal |
Description
ADAR Monoclonal antibody specifically detects ADAR in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
ADAR | |
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
Monoclonal | |
Purified | |
RUO | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
103 | |
IgG | |
Affinity purified |
7H1U2 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Human, Mouse, Rat | |
ADAR1DSH, adenosine deaminase, RNA-specific, DRADAP136, DSRADadenosine deaminase acting on RNA 1-A, EC 3.5.4, EC 3.5.4.-, G1P1double-stranded RNA-specific adenosine deaminase, IFI-4, IFI4dsRNA adenosine deaminase, interferon-induced protein 4, Interferon-inducible protein 4, K88DSRBP, p136,136 kDa double-stranded RNA-binding protein | |
Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human ADAR (P55265). STQAWNQHSGVVRPDGHSQGAPNSDPSLEPEDRNSTSVSEDLLEPFIAVSAQAWNQHSGVVRPDSHSQGSPNSDPGLEPEDSNSTSALEDPLEFLDMAEIK | |
Primary | |
Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title