Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ADAR Rabbit anti-Human, Mouse, Rat, Clone: 7H1U2, Novus Biologicals™
SDP

Catalog No. p-7246909 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB165863 20 μg
NB165862 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB165863 Supplier Novus Biologicals Supplier No. NBP31538320UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Rabbit Monoclonal Antibody

ADAR Monoclonal antibody specifically detects ADAR in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen ADAR
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 7H1U2
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias ADAR1DSH, adenosine deaminase, RNA-specific, DRADAP136, DSRADadenosine deaminase acting on RNA 1-A, EC 3.5.4, EC 3.5.4.-, G1P1double-stranded RNA-specific adenosine deaminase, IFI-4, IFI4dsRNA adenosine deaminase, interferon-induced protein 4, Interferon-inducible protein 4, K88DSRBP, p136,136 kDa double-stranded RNA-binding protein
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human ADAR (P55265). STQAWNQHSGVVRPDGHSQGAPNSDPSLEPEDRNSTSVSEDLLEPFIAVSAQAWNQHSGVVRPDSHSQGSPNSDPGLEPEDSNSTSALEDPLEFLDMAEIK
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 103
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.