ADAT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184285

Catalog No. NBP184285

Description

ADAT2 Polyclonal specifically detects ADAT2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ADAT2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q7Z6V5
• Gene Symbols: ADAT2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFE
• Quantity: 0.1 mL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 134637
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae), DEADC1, deaminase domain containing 1, Deaminase domain-containing protein 1, dJ20N2, dJ20N2.1, DKFZp686L1118, EC 3.5.4, EC 3.5.4.-, FLJ44213, TAD2, tRNA-specific adenosine deaminase 2, tRNA-specific adenosine deaminase 2 homolog, tRNA-specific adenosine-34 deaminase subunit ADAT2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only