Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Adenylate Cyclase 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19028025UL
Description
Adenylate Cyclase 2 Polyclonal specifically detects Adenylate Cyclase 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Adenylate Cyclase 2 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Q08462 | |
ADCY2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:HISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAK | |
25 μL | |
Lipid and Metabolism | |
108 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
3'-5'-cyclic AMP synthetase, AC2, adenylate cyclase 2 (brain), adenylate cyclase II, adenylate cyclase type 2, Adenylate cyclase type II, Adenylyl cyclase 2, ATP pyrophosphate-lyase 2, EC 4.6.1.1, FLJ45092, HBAC2, KIAA1060FLJ16822, MGC133314, type II adenylate cyclase | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction