Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Adenylate Cyclase 5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Adenylate Cyclase 5 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Adenylate Cyclase 5 Polyclonal specifically detects Adenylate Cyclase 5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Adenylate Cyclase 5 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
AC5, adenylate cyclase 5, adenylate cyclase type 5, Adenylate cyclase type V, Adenylyl cyclase 5, ATP pyrophosphate-lyase 5, EC 4.6.1.1 | |
ADCY5 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
111 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF',) | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title