Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Adenylate Cyclase 8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159027
Description
Adenylate Cyclase 8 Polyclonal specifically detects Adenylate Cyclase 8 in Human samples. It is validated for Western Blot.Specifications
Adenylate Cyclase 8 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
AC8, ADCY3, adenylate cyclase 8 (brain), adenylate cyclase type 8, Adenylate cyclase type VIII, Adenylyl cyclase 8, adenylyl cyclase-8, brain, ATP pyrophosphate-lyase 8, Ca(2+)/calmodulin-activated adenylyl cyclase, EC 4.6.1.1, HBAC1 | |
Rabbit | |
140 kDa | |
100 μL | |
Lipid and Metabolism | |
114 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P40145 | |
ADCY8 | |
Synthetic peptides corresponding to ADCY8(adenylate cyclase 8 (brain)) The peptide sequence was selected from the middle region of ADCY8 (NP_001106). Peptide sequence EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ. | |
Affinity purified | |
RUO | |
Primary | |
Reconstitute in 50μL of distilled water to a final antibody concentration of 1mg/mL. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction