Invitrogen™ Adenylate Kinase 1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578748

Catalog No. PIPA578748

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell lysates, human SiHa whole cell lysates, rat heart tissue lysates, mouse lung tissue lysates, mouse heart tissue lysates. IHC: human colon cancer tissue, human lung adenocarcinoma tissue, mouse heart tissue, rat heart tissue. Flow: PC-3 cell.

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.

Specifications

• Antigen: Adenylate Kinase 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: AK1
• Gene Alias: adenylate kinase 1; adenylate kinase isoenzyme 1; adenylate kinase isoenzyme 1 {ECO:0000255; Adenylate monophosphate kinase; adenylate monophosphate kinase {ECO:0000255; AK 1; AK 1 {ECO:0000255; Ak1; Ak-1; ATP:AMP phosphotransferase; ATP:AMP phosphotransferase {ECO:0000255; ATP-AMP transphosphorylase 1; ATP-AMP transphosphorylase 1 {ECO:0000255; B430205N08Rik; cytosolic adenylate kinase; HAMAP-Rule:MF_03171}; HTL-S-58j; I79_014777; Myokinase; myokinase {ECO:0000255; testis secretory sperm binding protein Li 58j
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11636, 203, 24183
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P00568, P39069, Q9R0Y5
• Gene Symbols: AK1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov